SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026853 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026853
Domain Number 1 Region: 344-445
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000026853
Domain Number - Region: 210-251
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.06
Family BphP N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026853   Gene: ENSCJAG00000014556   Transcript: ENSCJAT00000028383
Sequence length 860
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:73688793:73700324:1 gene:ENSCJAG00000014556 transcript:ENSCJAT00000028383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEVLEEIWSLSAQRAHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSG
NGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQK
ELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCSMD
MSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAAILLRCKRDVFRGTRFSE
LLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCRIRGGPDRDLGPRYQPF
RLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDER
AAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVT
MDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPVLPLDTDIQELSEQIHRL
LLQPVHSPSSTGFSGVGPMTSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLV
KHQGQQLFIESRAWPQPRTRLPATGTFKAKTLPCQSPDPELETGPAPIQAPLALAPEEAE
RKEASSSSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTTSSASDDDKQRTGPVPVG
TKKDPPSAVLSGEGATPRKEPVVGGTLSPLTLANKAESVVSATSQCSFSSTIVHVGDKKL
PESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTKAVLSLHTQKEEQAFLS
RFRDLGRLRGLDSSSTAPSALVRGSHPRPPGACPLPSLGLDCQGVDLKGGVSAPGTQAGA
ASGPRDWPHRTLGRTLASPH
Download sequence
Identical sequences F7I4A7
ENSCJAP00000026853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]