SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027130 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027130
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily DNA clamp 0.0000335
Family DNA polymerase processivity factor 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027130   Gene: ENSCJAG00000014735   Transcript: ENSCJAT00000028683
Sequence length 259
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:15071204:15086060:-1 gene:ENSCJAG00000014735 transcript:ENSCJAT00000028683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFSEFQMEGFSAENNEIYL
ELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELFSMSSSTRIATHDIPIKVIPRK
LWKDLQEPMVPDPDVSIYLPVLKTMKSVVEKMKNISSHLVIEANRDGELNLKIETELVCV
TTHFKDLGNPPLASESTSQDRNPEHMAEVHIDIRKLLQFLAGQQVNPTKALCNIVTNKMV
HFHLLHEDVSLQYFIPALS
Download sequence
Identical sequences F7CW16
ENSCJAP00000027130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]