SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027149 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027149
Domain Number 1 Region: 182-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.5e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000529
Further Details:      
 
Domain Number 2 Region: 40-109,137-236,420-466
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000499
Family C-terminal domain of adrenodoxin reductase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027149   Gene: ENSCJAG00000014726   Transcript: ENSCJAT00000028702
Sequence length 495
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:124085374:124095216:-1 gene:ENSCJAG00000014726 transcript:ENSCJAT00000028702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGRSAWPWTPPLSVGSIPSFRHQFSTQETTPQICVVGSGPAGFYTAQHLLKV
SHFLIDLESRVLNAPAVWEGEECSGGRSLSLRRTSCHPVFQQHPQAHVDIYEKQPVPFGL
VRFGVAPDHPEVKNVINTFTQTAHCGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAED
HRALEIPGEELPGVCSARAFVGWYNGLPENQELKPDLSCDTAVILGQGNVALDVARILLT
PPEHLEKTDITKAALDVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGTRPILDPV
DFLGLQDRLKEVPRPRKRLTELLLRTAMEKPGPEEAARRASASRAWGLRFFRSPQQVLPS
PDGRGAAGVRLAVTRLEGVGEATRAVPTGAMEDLPCGLVLSSIGYKSRPIDPSVPFDSKL
GVIPNVEGRVTDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPG
SAAIQALLSSRGLGP
Download sequence
Identical sequences F7HFQ2
ENSCJAP00000027158 ENSCJAP00000027149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]