SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027188 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027188
Domain Number 1 Region: 434-922
Classification Level Classification E-value
Superfamily ALDH-like 8.25e-166
Family ALDH-like 0.000000000703
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 3.4e-50
Family Formyltransferase 0.000000018
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.18e-25
Family Post formyltransferase domain 0.0000183
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000027188
Domain Number - Region: 346-418
Classification Level Classification E-value
Superfamily ACP-like 0.00171
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027188   Gene: ENSCJAG00000014729   Transcript: ENSCJAT00000028741
Sequence length 923
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:95055845:95122987:-1 gene:ENSCJAG00000014729 transcript:ENSCJAT00000028741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALVAEKDGTPVFKFPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDTLYNRFLFPEGIKAMVEAVQRIADGKAPRIPQPEEGATYEGIQKKENAEISWNWSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPSGEPLEIKGAKKPGLITKNGLVI
FGNDGKALMVRNLQFEDGRMIPASQYFSAGETSVVELTAEEVKVAETIKVIWAGILSNVP
VIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEAELVVDYVSKEVNEMTVKMPYQCFINGQFTDADDGKTYDTINPTDGSIICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYASEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences F7H088
ENSCJAP00000027188 ENSCJAP00000027188 XP_002752979.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]