SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027194 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027194
Domain Number 1 Region: 391-420,453-557,679-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-55
Family Phosphate binding protein-like 0.0000000789
Further Details:      
 
Domain Number 2 Region: 72-376
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.59e-22
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027194   Gene: ENSCJAG00000014754   Transcript: ENSCJAT00000028748
Sequence length 1244
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:124058951:124081283:-1 gene:ENSCJAG00000014754 transcript:ENSCJAT00000028748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGALGLALLLTSLLGASAGPGPGQGEQGVTVAVVFGSSGPPQAQVSARLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICSLLGAARIHGIVFEDNVGTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHLSWRLLDVVTLELGPGEQRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPAAFPVGLISVVTESWRLSLRQKVRDGVAVLALGA
HGYRRQHGTLPAPAGDCRAHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLLQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPSFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALSSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALMVFAWEHLVY
WKLRHSVPNTSQLDFLLAFSRGIYSCFSGVQSLASPPRQPSPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGLRAPPPPPCPTPRSGPSPRPPTPGPPPEPSPKGW
GPPDGGRAGLVRRAPQPPGRPPTPGPPLPDVSRVSRRPAWEAWWPVRAGHCGRHLSASER
RALPQRPLSPALCHYSSFPRADRSGRPFLPLFPEPPEPEDLPLLRPEQLARREALLHAAW
ARGSRPRHASLPSSVAEAFARPSSLPAGCTGPACARPDGHTACRRLAQAQSMCLPTYQEA
CKEGEQAGSPAWRHRQHVCLHAHAHAHLPFCWGAVCPHLPPCASQSSWPTGAWGSLGHRG
RTLGLGTGYRDSGGLGGVSRVACGTQGFLGPCTWRRISSLESEV
Download sequence
Identical sequences F7H046
XP_002806915.1.60252 ENSCJAP00000027194 ENSCJAP00000027194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]