SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027461 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027461
Domain Number 1 Region: 87-331
Classification Level Classification E-value
Superfamily vWA-like 2.22e-86
Family Integrin A (or I) domain 0.0000000467
Further Details:      
 
Domain Number 2 Region: 329-416
Classification Level Classification E-value
Superfamily Integrin domains 3.87e-24
Family Integrin domains 0.00031
Further Details:      
 
Domain Number 3 Region: 580-663
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.72e-19
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 538-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 5 Region: 496-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 6 Region: 38-113
Classification Level Classification E-value
Superfamily Integrin domains 0.0000141
Family Integrin domains 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000027461
Domain Number - Region: 463-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family Integrin beta EGF-like domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027461   Gene: ENSCJAG00000014862   Transcript: ENSCJAT00000029027
Sequence length 746
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:58793603:58870266:1 gene:ENSCJAG00000014862 transcript:ENSCJAT00000029027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITYKNFTHSSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGTQKNSSDIV
QIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLHTIKELGSRLSKE
MSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNNAER
FNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKL
AGIVIPNDGLCHLDSKNEYSMSTLLEYPTIGQLIDKLVQNNVLLIFAVTQEQVRLYENYA
KLIPGATVGVLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAMCNNGTLFPH
QKKCSHMKVGDTASFNVTVNIPNCERRSRHIIIKPVGLGDALEILVSPECNCDCQKEVEV
NSSKCHHGNGSFQCGVCACHPGHMGPHCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQC
ICYLSPYGNIYGTYCQCDNFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDS
CVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAVGQAR
EECVDKCKLAGATVSEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDC
PKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLY
RGSTSTFKNVTYKHREKQKVDLSADG
Download sequence
Identical sequences F7G5B8
ENSCJAP00000027461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]