SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027664 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027664
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 8.77e-34
Family C-type lectin domain 0.00074
Further Details:      
 
Domain Number 2 Region: 349-488
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-32
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 3 Region: 1372-1517
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-27
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1108-1224
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1532-1665
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-26
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 6 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.78e-25
Family Cysteine rich domain 0.0098
Further Details:      
 
Domain Number 7 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 6.41e-25
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 1241-1361
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-19
Family C-type lectin domain 0.007
Further Details:      
 
Domain Number 9 Region: 497-624
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-18
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 10 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000206
Family Fibronectin type II module 0.0025
Further Details:      
 
Domain Number 11 Region: 949-1094
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000262
Family C-type lectin domain 0.0045
Further Details:      
 
Domain Number 12 Region: 799-932
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000287
Family C-type lectin domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027664   Gene: ENSCJAG00000014982   Transcript: ENSCJAT00000029237
Sequence length 1730
Comment pep:novel chromosome:C_jacchus3.2.1:6:59073970:59286487:1 gene:ENSCJAG00000014982 transcript:ENSCJAT00000029237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRWATPRRAVVLLILLLWCFELAEPSAHAGNDPFTIVHGNTGKCIKPLNSWIVAKDCV
GTGDMLWKWVSQHRLFHLKSQKCLGLDITKPVDSLRMFSCDSSAMLWWKCEHHSLYGAAQ
YRLALKNGHGTAIWNASDVWKKGGSEESLCDQPYHEIYTKDGNSYGRPCEFPFLIDGTWH
HECILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNERFGSCYQFNTQAALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIARIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHTKCKAFGSDLISIHSLADVEVVVIKLHNEDAKEE
IWTGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKKKGEKRNDTSSDKMCPPDEGWKRHGETCYKIYEDEAPFGTNCNLTITSRFEQEY
LNDLMKKYDKSRRKYFWTGLRDVDSHGEYNWATVGGRKQAVTFSNWNFLEPASPGGCVAM
STGKSLGKWEVKDCRSFRALSICRKISGPLEPEEAAPKPDEPCPEGWQSLPSSLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHADELKDFLHFLMDQFSGQHWLWIGLNKRSP
DLQGSWQWSDHTPVSTVIMPNEFQQDYDIRDCAAVKVIHRPWRRGWHFFDDREFIYLRPF
ACDTKLEWVCQIPKGHTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADVHLNYEEAVLYC
ASNHSFLATVTSFAGLRAIRNKIANISGAEQKWWMRTSEEPIDHYFSYSRYPWHRFHVTF
GEECLYMSPKTWLMDLGKPVDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEHWIPFQN
KCFLKIKPKSLTFSNYLGNMFYSDLGPDQMLFKNLFLTDFITSLLPDMEATLWIGLRWTA
YERISKWTDNRELTYSNFHPLLVSRRLRLPENFFDEESRYHCALILNLQKSPFTGTWNFT
SCSERHFVSLCQKYSEVKGRPTLQNASETVKYLNNLYKIIPKTLTWHNAQRECLKNNMQL
VSITDSYQQAFLSVQALLQNSSLWIGLSSQDDELNFGWSDGKRLHFSRWAETNGQLEDCV
ILDTDGFWKTADCDDNQPGAICYYAGNETEKEVKPVDSVKCPSPILNTPWIPFQNCCYNF
MITKNRHTATTQDEVQSKCQKLNPKAHILSIRDEKENNFVLEQLLYFNYMASWVILGITY
ENNSLMWIDKTALSYTHWRAGRPTIKNDKFLAGLSTDGFWDIQTFNVIEEILYFHQHSIL
ACKIEMVDYKEEYNTTLPQFMLYEDGIYSVIQKKVTWYEALNMCSQSGGYLASVHDQNGQ
LFLEDIVKRDGFPLWLGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCLFLEPKGTWK
HEKCTSVKDGAICYKPTKPKKLSHLTYSSRCPAAKGNESRWIQYKGHCYTSDQALHSFSE
AKKLCPERADHSATIVSIKDEDENKFVSRLMKENNNITMRVWLGLSQHSVDQSWSWLDGS
EVTFFKWENKSKRDVGKCSMLVASNETWKKVECEHGFGRVVCKVPLGPDYRAIAISIATL
SILILVGGLIWFLFQRRRLYLAGFSSVQYAQGVNEDEIMLPSLQGKNLED
Download sequence
Identical sequences F7GGS7
ENSCJAP00000027664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]