SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027767 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027767
Domain Number 1 Region: 359-561
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-29
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 72-198
Classification Level Classification E-value
Superfamily POZ domain 3.35e-27
Family BTB/POZ domain 0.0027
Further Details:      
 
Domain Number 3 Region: 593-659
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000942
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027767   Gene: ENSCJAG00000015068   Transcript: ENSCJAT00000029341
Sequence length 708
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:113431795:113443219:-1 gene:ENSCJAG00000015068 transcript:ENSCJAT00000029341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVAAAAAAAAAASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEAS
GGDPGPEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATE
YFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELA
DRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEE
FYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPT
YLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTFQLPTSHVSLLPRYGQNMDV
IMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFA
KTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDK
WHNLESAPKILRDVKALGIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESL
PLIDNYCFFQMSVVNSNFYQTASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIE
GAAICYYKDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVR
IPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
Download sequence
Identical sequences A0A2K5QCW7 F7HEX1
ENSCJAP00000027770 ENSCJAP00000027767 XP_002748667.1.60252 XP_017364928.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]