SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027808 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027808
Domain Number 1 Region: 11-128
Classification Level Classification E-value
Superfamily POZ domain 1.14e-31
Family BTB/POZ domain 0.00054
Further Details:      
 
Domain Number 2 Region: 395-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 431-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027808   Gene: ENSCJAG00000036210   Transcript: ENSCJAT00000029386
Sequence length 584
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:3703603:3713341:-1 gene:ENSCJAG00000036210 transcript:ENSCJAT00000029386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGVDGPIGIPFPDHSIDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQHNLYEIYFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLTPAAAAAA
ASFPWSAFGASDDDLDATKEAVAAAVAAVAGDCNGLDFYGPGPPTERPPTADGEEGDSNP
GLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGAA
EGEDGDGPDVDGLAASTLLQQMMSSVGRAGTAAGDSDEESRADDKGVMDYYLKYFSGAHD
GDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTR
QDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHL
HRHLKKDGCNGVPSRRGRKPRVRGGGPDPSPGATAATPGAPAQPGSPDARRNGQEKHFKD
EDEDEDVASPDGLGRLNAAGAGGGGDSGGGPGAATDGNFTAGLV
Download sequence
Identical sequences F7GTZ9
ENSCJAP00000027806 ENSCJAP00000027808 XP_002761633.1.60252 ENSCJAP00000027806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]