SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027886 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000027886
Domain Number - Region: 33-80
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0942
Family Intein (protein splicing domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027886   Gene: ENSCJAG00000015070   Transcript: ENSCJAT00000029466
Sequence length 259
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:203976129:204019996:1 gene:ENSCJAG00000015070 transcript:ENSCJAT00000029466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSS
ILPRRGALLKVNQELAGYTGGDVSFIKEDFELQVNKPLIFDSVFSASLWGGMLVPIGDKP
SSIADRFYLGGPTSVRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGEL
FRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCIPMGV
QTGDRICDGVQFGAGIRFL
Download sequence
Identical sequences F7FRL7
ENSCJAP00000027886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]