SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027980 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027980
Domain Number 1 Region: 102-235
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.04e-31
Family Endonuclease III 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027980   Gene: ENSCJAG00000015178   Transcript: ENSCJAT00000029567
Sequence length 238
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:2555469:2559427:1 gene:ENSCJAG00000015178 transcript:ENSCJAT00000029567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSPQEFGMNAWSGRMLTRSRSRSRGPGAGPRRCREEPEPLRKGEAAAERRKSHSPMKHQ
RKAQRLCVAYEGSDSEKGEGAEPLKVPVWEPQNWQQQLANIRAMRSKKDAPVDHLGAEHC
YDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRAQGLTVDSILQTDDATLGKLIYP
VGFWRSKVKYIKQTSAILQQCYGGDIPASVAELVALPGVGPKMAHLAMAVAWGIVSGI
Download sequence
Identical sequences F7H9D2
ENSCJAP00000027980 ENSCJAP00000027980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]