SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028007 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028007
Domain Number 1 Region: 11-109
Classification Level Classification E-value
Superfamily PapD-like 1.05e-19
Family MSP-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028007   Gene: ENSCJAG00000015186   Transcript: ENSCJAT00000029595
Sequence length 223
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:11402192:11405902:-1 gene:ENSCJAG00000015186 transcript:ENSCJAT00000029595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGAPQDQELVAPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCT
APAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDIT
SVLRAPAYPLELQGQPDPTPHPGPPTGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSV
AFLLLPLQDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT
Download sequence
Identical sequences F6Y640
ENSCJAP00000028007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]