SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028121 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028121
Domain Number 1 Region: 248-375
Classification Level Classification E-value
Superfamily TPR-like 1.14e-23
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 117-245
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-23
Family FKBP immunophilin/proline isomerase 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028121   Gene: ENSCJAG00000015259   Transcript: ENSCJAT00000029717
Sequence length 435
Comment pep:novel chromosome:C_jacchus3.2.1:22:17537842:17552204:-1 gene:ENSCJAG00000015259 transcript:ENSCJAT00000029717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQSGPEARVPLRTSRGAKDPRRGSRSQRASSRPPSSMASCAEPSEPSAPPPAGVPPLEDF
EVLDGVEDDDLSELPPLEDMGQPLAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILG
NGLLRKKTLVPGPPGSSHPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDL
SVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQER
VALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNN
LAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEP
SNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAV
ALGGVALSVVIAARN
Download sequence
Identical sequences F7B9F4
ENSCJAP00000028121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]