SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028182 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028182
Domain Number 1 Region: 18-113
Classification Level Classification E-value
Superfamily POZ domain 3.93e-27
Family Tetramerization domain of potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 207-459,534-574
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.24e-18
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028182   Gene: ENSCJAG00000015237   Transcript: ENSCJAT00000029787
Sequence length 817
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:9226491:9281250:-1 gene:ENSCJAG00000015237 transcript:ENSCJAT00000029787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGHCGSFAAAAAGSGEIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETG
AIFIDRDPAAFAPILNFLRTKELDLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSC
GSVLFHGYLPPPGIPSRKINNTVRSADSRNGLNSTEGEARGNGTQPVLSGTGEDTVRLGF
PVDPRKVLIVAGHHNWIVAAYAHFAVCYSLKTESGWQQVFTSPIFGWTIERVALNKVVGG
PHGDKDKMVAVASESSIILWSVQDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTGKVG
VWNAVTQHWQVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYH
DPSNDAITALSVYLTPKTSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHR
SPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLEETESHGS
YSSGNDIDQGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKSRICEIQAVDCTTISSFTV
RECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQ
CDLSTSRCATPNISPATSVVQHSHLRESNSSLQLQHHETIHEAATYGSVRPYRESPLLAR
ARRTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAEVKGATGECNISERKSPGIEIKS
LRELDSGLEVHKIAEGFSESKKRSSEDENENKIEFRKKGGFEGGGFLGRKKVPYLASSPS
TSDGGTDSPGTASPSPTKTTPSPRHKKSDSSGQEYSL
Download sequence
Identical sequences F6Z7G2
ENSCJAP00000028171 ENSCJAP00000028182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]