SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028286 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028286
Domain Number 1 Region: 210-350
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 53-84,134-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-23
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028286   Gene: ENSCJAG00000015327   Transcript: ENSCJAT00000029891
Sequence length 422
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:9528513:9751858:-1 gene:ENSCJAG00000015327 transcript:ENSCJAT00000029891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNPRAKRNFYLAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVST
IFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAA
INAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPL
FGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAII
FKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVL
SMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRK
LSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIAVIEN
IK
Download sequence
Identical sequences A0A1D5QMX8 A0A2I3GRL9 A0A2K5DCJ8 A0A2K5JDX6 A0A2K5KVK4 A0A2K5Q554 A0A2K5TJT2 A0A2K6A9X0 A0A2K6CLN9 A0A2K6MLH1 F6UIJ9 G3SB45 K7A9D5
XP_002760566.1.60252 XP_003265160.1.23891 XP_003814202.1.60992 XP_005540899.1.63531 XP_007986641.1.81039 XP_011759525.1.29376 XP_011784807.1.43180 XP_011851553.1.47321 XP_011896098.1.92194 XP_012315073.1.9421 XP_012315074.1.9421 XP_012637208.1.48125 XP_014971783.1.72884 XP_017364708.1.71028 XP_017725425.1.44346 XP_514195.3.37143 ENSCJAP00000028286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]