SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028292 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028292
Domain Number 1 Region: 214-354
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 57-88,138-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-23
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028292   Gene: ENSCJAG00000015327   Transcript: ENSCJAT00000029897
Sequence length 426
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:9527916:9681706:-1 gene:ENSCJAG00000015327 transcript:ENSCJAT00000029897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
Download sequence
Identical sequences A0A2K5DCM9 A0A2K5JDR1 A0A2K5Q5B9 A0A2K6A9W2 A0A2K6CLP8 A0A2K6ML94 A0A2K6QF93 F6UI26 G1RW39 G3S7X7 G7MEK1 G7NTZ8 H2RCA8 O95069
ENSPTRP00000057026 ENSP00000394033 ENSGGOP00000024187 gi|126365795|ref|NP_001017425.2| ENSNLEP00000017466 NP_001017425.2.87134 NP_001017425.2.92137 XP_001171677.1.37143 XP_002760565.1.60252 XP_003265158.1.23891 XP_003814200.1.60992 XP_004028443.1.27298 XP_005540898.1.63531 XP_007986640.1.81039 XP_008983458.1.60252 XP_010355060.1.97406 XP_011759524.1.29376 XP_011784806.1.43180 XP_011851552.1.47321 XP_011896097.1.92194 XP_012315071.1.9421 XP_012315072.1.9421 XP_012637205.1.48125 XP_012637206.1.48125 XP_012637207.1.48125 XP_014971776.1.72884 XP_017364706.1.71028 XP_017364707.1.71028 XP_017725424.1.44346 ENSP00000420499 ENSNLEP00000017466 ENSP00000394033 9598.ENSPTRP00000059566 9606.ENSP00000394033 ENSPTRP00000057026 ENSCJAP00000028292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]