SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028310 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028310
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.31e-39
Family Nip7p homolog, N-terminal domain 0.00000213
Further Details:      
 
Domain Number 2 Region: 94-169
Classification Level Classification E-value
Superfamily PUA domain-like 7.18e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028310   Gene: ENSCJAG00000015364   Transcript: ENSCJAT00000029916
Sequence length 179
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:23198686:23200618:1 gene:ENSCJAG00000015364 transcript:ENSCJAT00000029916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMLKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGD
KLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRI
TENTSQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences F7BQT9
ENSCJAP00000028310 ENSCJAP00000028310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]