SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028312 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028312
Domain Number 1 Region: 211-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-26
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 57-88,138-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-22
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028312   Gene: ENSCJAG00000015327   Transcript: ENSCJAT00000029918
Sequence length 429
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:9527916:9681702:-1 gene:ENSCJAG00000015327 transcript:ENSCJAT00000029918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLFLSLVGGNINLILIRTKGVVHMKIFKKWNVSQTKIRIISTIIFILFGCVLF
VALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGL
AYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQR
ATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGE
EIAVIENIK
Download sequence
Identical sequences F7BQQ7
ENSCJAP00000028312 ENSCJAP00000028312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]