SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028344 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028344
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.57e-42
Family eIF-2-alpha, C-terminal domain 0.000000567
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028344   Gene: ENSCJAG00000015368   Transcript: ENSCJAT00000029951
Sequence length 315
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:92559285:92581621:1 gene:ENSCJAG00000015368 transcript:ENSCJAT00000029951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences A0A2K5CXJ7 A0A2K5R0C6 A0A2K6V7V6 F7ANJ2
ENSCJAP00000028344 XP_002754073.1.60252 XP_003924500.1.74449 XP_009004454.1.60252 XP_009004455.1.60252 XP_010333487.1.74449 XP_012293442.1.9421 XP_012293443.1.9421 XP_017356267.1.71028 XP_017356271.1.71028 XP_017356277.1.71028 ENSCJAP00000028344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]