SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028464 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028464
Domain Number 1 Region: 11-90
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000546
Family G proteins 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028464   Gene: ENSCJAG00000007026   Transcript: ENSCJAT00000030079
Sequence length 99
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:63381132:63474130:1 gene:ENSCJAG00000007026 transcript:ENSCJAT00000030079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDEVSVSLRLWDTFGDHHKDRRFAYGR
Download sequence
Identical sequences A0A2I2ZH76 F6V3Y0 Q567T3
XP_010225403.1.20684 28377.ENSACAP00000010787 ENSCJAP00000028464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]