SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028522 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028522
Domain Number 1 Region: 65-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-28
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028522   Gene: ENSCJAG00000015490   Transcript: ENSCJAT00000030137
Sequence length 235
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:64387687:64536023:-1 gene:ENSCJAG00000015490 transcript:ENSCJAT00000030137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKG
Download sequence
Identical sequences A0A1D5QMJ0 A0A2I2YKL1 A0A2I3HCJ3 A0A2I3NAE0 A0A2I3RBW4 A0A2J8V782 A0A2K5CU71 A0A2K5KAT8 A0A2K5KUQ1 A0A2K5R996 A0A2K5VCZ6 A0A2K5ZAT3 A0A2K6DSP6 A0A2K6KTD5 A0A2K6N7J2 A0A2K6T194 F7B6N5
ENSCJAP00000028522 NP_001247437.1.87134 NP_001247437.1.92137 XP_003949951.1.37143 XP_004090932.1.23891 XP_005573263.1.63531 XP_007963182.1.81039 XP_010386071.1.97406 XP_011759060.1.29376 XP_011782847.1.43180 XP_011847363.1.47321 XP_011893797.1.92194 XP_014965614.1.72884 XP_017378681.1.71028 XP_017709067.1.44346 XP_017828964.1.60252 ENSP00000438410 ENSP00000438410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]