SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028701 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000028701
Domain Number - Region: 366-416
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 76-150,207-278
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0581
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number - Region: 293-337
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0766
Family Inhibitor of apoptosis (IAP) repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028701   Gene: ENSCJAG00000015544   Transcript: ENSCJAT00000030328
Sequence length 434
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:56653522:56701220:1 gene:ENSCJAG00000015544 transcript:ENSCJAT00000030328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNC
GTFTRGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTR
NGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETTVPETGESLASEFLFSDM
CRVETGENCSSPAPKEELVPAEETEEDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKP
SKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGL
ERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFP
RMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLL
GHPPHMNVNPQQPA
Download sequence
Identical sequences F7BMC7
ENSCJAP00000028701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]