SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028718 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028718
Domain Number 1 Region: 180-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.36e-51
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 17-129
Classification Level Classification E-value
Superfamily POZ domain 1.41e-29
Family Tetramerization domain of potassium channels 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028718   Gene: ENSCJAG00000015595   Transcript: ENSCJAT00000030346
Sequence length 477
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:96118052:96121839:-1 gene:ENSCJAG00000015595 transcript:ENSCJAT00000030346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD
DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS
YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP
GYSVLSRVFSILSILVVMGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF
ELVARFAVAPDFLKFFRNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLM
RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT
IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
KQLESAMRSCDFGDGMKEVPSINLRDYYAHKVKSLMASLTNMSGSSPSELSLNDSLH
Download sequence
Identical sequences F7B4N0
ENSCJAP00000028718 XP_002759409.1.60252 ENSCJAP00000028718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]