SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028868 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028868
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-40
Family ALDH-like 0.00000857
Further Details:      
 
Domain Number 2 Region: 361-428
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000869
Family ALDH-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028868   Gene: ENSCJAG00000015676   Transcript: ENSCJAT00000030507
Sequence length 457
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:123522170:123536623:1 gene:ENSCJAG00000015676 transcript:ENSCJAT00000030507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLRETFHAGHTRPAEFRAAQLRGLGHFLQDNKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNLRAWMKDEHVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKSIEKVLAEELPRYLDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGEAGTRAGTVFELMRDRRSSRKTVVLGGEAVPCRDSGSCRTLILGHKGEKCQG
HPHRLKNTKRHQQSLPTLPRPSDSKSIPSTFELFVQQQFRVYQSFFPFSLQSSKGQACFS
SANLTTSLCLHVPVLTPHSPSASTLPGAPSLPEQLLSLLNPPLSRHMRPLPWDASRNMSQ
VVRRILAQTSSGGFCGNDGFMHMTLASLPFGGVAGASGIGRYHGKFSFDTFSHHRACLLR
SPGMEKLNAIRYPPHSPRRLRVLLVAMEARGCSCTLL
Download sequence
Identical sequences F6W5S2
ENSCJAP00000028868 ENSCJAP00000028868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]