SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028964 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028964
Domain Number 1 Region: 6-20,51-297
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.19e-100
Family Inorganic pyrophosphatase 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028964   Gene: ENSCJAG00000015715   Transcript: ENSCJAT00000030605
Sequence length 299
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:88224046:88308860:1 gene:ENSCJAG00000015715 transcript:ENSCJAT00000030605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAENVTGHYISPFHDIPLKVNSKEDTEAQGIFIDLCKIWENCLPTKKAQNDENDNLFNMI
VEIPRWTNAKMEIATEEPLNPIKHYVKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPCQK
DKSTNCCGDNDPIDVCEIGSKILSCGEVIQVKILGILALIDEGETDWKLIAINVNDPEAS
KFRDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFRNKAFALEVVKSTHQCW
KALLMKKCNGGTINCTNVQVSESPFCCTQEEARSLVESVSSSPNKESNKEEQVWHFLGK
Download sequence
Identical sequences F7BLF6
ENSCJAP00000028964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]