SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028965 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028965
Domain Number 1 Region: 31-88
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000000000175
Family Leucine zipper domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028965   Gene: ENSCJAG00000015732   Transcript: ENSCJAT00000030606
Sequence length 124
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:12030056:12045565:1 gene:ENSCJAG00000015732 transcript:ENSCJAT00000030606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTAPVGSDRMGQSRVEGPRHHTHPLPQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKL
HEEYECLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAG
CLPR
Download sequence
Identical sequences F7BLE5
ENSCJAP00000028961 ENSCJAP00000028965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]