SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028984 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028984
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-41
Family FKBP immunophilin/proline isomerase 0.00000067
Further Details:      
 
Domain Number 2 Region: 256-409
Classification Level Classification E-value
Superfamily TPR-like 1.95e-32
Family Tetratricopeptide repeat (TPR) 0.0000000939
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 1e-26
Family FKBP immunophilin/proline isomerase 0.000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028984   Gene: ENSCJAG00000015725   Transcript: ENSCJAT00000030628
Sequence length 457
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:36516462:36642892:-1 gene:ENSCJAG00000015725 transcript:ENSCJAT00000030628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNSRENPAATVAEQGEDVTSKKDRGVLKIVKRVGHGEETPMIGDKVYVHYNGK
LSNGKKFDSSHDRNEPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGATGSLP
KIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRV
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTLYFKGGKYVQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYAKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQIIVCQKKAKEHNERDRRIYANMSRSLLVIY
TKEEANKAMSKKTSEGVTNEKLTVSHAVEEEKPEGHV
Download sequence
Identical sequences F7B306
ENSCJAP00000028979 ENSCJAP00000028984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]