SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029101 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029101
Domain Number 1 Region: 171-319
Classification Level Classification E-value
Superfamily MIR domain 3.84e-39
Family MIR domain 0.00000514
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000029101
Domain Number - Region: 108-151
Classification Level Classification E-value
Superfamily MIR domain 0.000942
Family MIR domain 0.012
Further Details:      
 
Domain Number - Region: 653-703
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00602
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 368-437,494-565
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00863
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029101   Gene: ENSCJAG00000015544   Transcript: ENSCJAT00000030754
Sequence length 721
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:56339801:56701066:1 gene:ENSCJAG00000015544 transcript:ENSCJAT00000030754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVCNKIIFLMSFVGNCGTFTRGYRAMVLD
VEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLAL
ILVYLFSIVGYLFFKDDFILEVDRLPNETTVPETGESLASEFLFSDMCRVETGENCSSPA
PKEELVPAEETEEDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIY
DLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFE
EHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSE
GEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQP
A
Download sequence
Identical sequences F7IHF3
ENSCJAP00000029101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]