SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029287 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029287
Domain Number 1 Region: 197-370,398-466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.45e-16
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000029287
Domain Number - Region: 19-82
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0157
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029287   Gene: ENSCJAG00000015902   Transcript: ENSCJAT00000030948
Sequence length 518
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:124592033:124633757:1 gene:ENSCJAG00000015902 transcript:ENSCJAT00000030948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQFAGGKQDDGQDRERLTYFRNLPESLTSLLVLLTTANNPDVMVPAYSKNRAYAIFFIV
FTVIGDLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSVAGEEGAFPQA
AGVKPQNLLQVLQRVQLDSSHKEAMMEQVHSYGSVPLSADEFQKLFNELDRSVVKEHPRR
PTYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFVLGILNC
VFIVYYLLELLLKVFALGLRGYLSYPSNVFDGLLTIVLLVLEISTLAVYRLPHPGWRPEM
LGLLSLWDMTRMLNMLIVFRFLRIIPNMKPMAVVASTVLGLVQNMRAFGGILVVVYYVFA
IIGINLFRGVIVAPLGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNN
WQVLLDAFRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPHSYLQPLAGTP
EATYQMTVELMFRDILEEPKEDELTETLSHHPHLRLCR
Download sequence
Identical sequences F7IP77
ENSCJAP00000029287 ENSCJAP00000029287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]