SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029682 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029682
Domain Number 1 Region: 186-300,422-568
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.54e-65
Family Phosphate binding protein-like 0.00000000162
Further Details:      
 
Domain Number 2 Region: 10-171
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.46e-21
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 324-419
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000497
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029682   Gene: ENSCJAG00000016110   Transcript: ENSCJAT00000031366
Sequence length 657
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:111278709:111380358:1 gene:ENSCJAG00000016110 transcript:ENSCJAT00000031366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSFHIILSTLTDMGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPE
AKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERA
LKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDS
ASAENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGD
GKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKP
QKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPP
DPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLT
VERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKT
TADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNA
VNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGL
AMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences F7IP00
ENSCJAP00000029682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]