SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029857 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029857
Domain Number 1 Region: 187-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.89e-41
Family NadC C-terminal domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000029857
Domain Number - Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.00012
Family NadC N-terminal domain-like 0.016
Further Details:      
 
Domain Number - Region: 86-118
Classification Level Classification E-value
Superfamily DUSP-like 0.0785
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029857   Gene: ENSCJAG00000016193   Transcript: ENSCJAT00000031549
Sequence length 491
Comment pep:novel chromosome:C_jacchus3.2.1:8:74746725:74786815:-1 gene:ENSCJAG00000016193 transcript:ENSCJAT00000031549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFY
GLQYILNKYLKGKVITKEKIQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKLKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNIELEAAPH
Download sequence
Identical sequences F7IR89
ENSCJAP00000029857 ENSCJAP00000029857 XP_002751770.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]