SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030604 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030604
Domain Number 1 Region: 412-702
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-76
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 256-339
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-34
Family Kringle modules 0.00037
Further Details:      
 
Domain Number 3 Region: 7-99
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-21
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000030604
Domain Number - Region: 115-202
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00222
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030604   Gene: ENSCJAG00000016620   Transcript: ENSCJAT00000032339
Sequence length 882
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:99491128:99652568:1 gene:ENSCJAG00000016620 transcript:ENSCJAT00000032339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRISFRTTIYGSR
LRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRG
IACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYC
DETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAAN
CIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPEL
NGGHSYCRNPGNQKEAPWCFTLDENFKFDLCDIPACDSKDSKEKNKMEILYILVPSVAIP
LAIALLFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRF
MEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNI
VCLLGAVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHI
AIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLP
IRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSE
DCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSA
SPVSNLSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAH
YQPAGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPG
GMGITVFGNKSQKPYKIDSKQPSLLGDSNIHGHTESIISAEL
Download sequence
Identical sequences F7CKH4
ENSCJAP00000030604 ENSCJAP00000030604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]