SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030680 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030680
Domain Number 1 Region: 84-175
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 7.06e-41
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 6-124
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-22
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030680   Gene: ENSCJAG00000016659   Transcript: ENSCJAT00000032420
Sequence length 268
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:92313463:92346276:-1 gene:ENSCJAG00000016659 transcript:ENSCJAT00000032420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRGTVSVFKAAYCLPSLAHQFFRYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCG
KGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETW
LIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYD
MISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMEGYDKHV
TYNTERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences F6ZNW0
ENSCJAP00000030680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]