SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030744 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030744
Domain Number 1 Region: 162-345
Classification Level Classification E-value
Superfamily vWA-like 0.00000000297
Family Integrin A (or I) domain 0.049
Further Details:      
 
Domain Number 2 Region: 653-761
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000753
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030744   Gene: ENSCJAG00000016656   Transcript: ENSCJAT00000032490
Sequence length 1213
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:100101778:100218173:1 gene:ENSCJAG00000016656 transcript:ENSCJAT00000032490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLSFLYYPPLKNGDSRTTIIPQLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTA
IQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLNSVLADNLKSNPGI
KWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQL
QIAKDAAQVILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATSETKRKMSTFVSSV
KSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKETLRV
INEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRTTLPVIKGSMM
VLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVG
VDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEAPLHTDIIHYENIP
KFELVRQNILSQHSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWKMVQDTSFI
LCIVVIQPEVPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLESPTVMLSAGS
FSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHVTDEWMTQMEM
SSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGG
AGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIM
EDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRF
YKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSMVDRLCLNC
HRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTAIDPGLQDALHQCVN
SRCSQRLESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAKSPYVDDMGAI
GDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRM
SNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGTESDHGYSTMS
PQEDSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFHHYRSHHPTLHHSHHL
QAAVTVHTVDAEC
Download sequence
Identical sequences F6WT47
ENSCJAP00000030744 ENSCJAP00000042876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]