SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030835 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030835
Domain Number 1 Region: 30-183
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.67e-31
Family UbiE/COQ5-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030835   Gene: ENSCJAG00000016763   Transcript: ENSCJAT00000032586
Sequence length 243
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:7954396:7961077:1 gene:ENSCJAG00000016763 transcript:ENSCJAT00000032586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEEAGSLPEVLARVGAAHGIPDVAQKLHFYDRWAPDYDQDVATLQYRAPRLAVDCLTQ
AFPGPPHSALILDVACGTGLVAAELQARGFLQLHGVDGSPEMLKRARARGLYQRLSLCTL
GQEPLPSPEGTFDAVLIVGALSDGQVPCSAIPELLRVTKPGGLVCLTTRTNSSNLQYKEA
LEATLDSLEQAGVWERLVALPVEHWELATSELEVVPGTSAKDGFISGIIYLYQKQKSTQV
EEV
Download sequence
Identical sequences F7BNV2
ENSCJAP00000030835 ENSCJAP00000030835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]