SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030938 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000030938
Domain Number - Region: 108-165
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00157
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030938   Gene: ENSCJAG00000016807   Transcript: ENSCJAT00000032694
Sequence length 250
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:8120186:8124371:-1 gene:ENSCJAG00000016807 transcript:ENSCJAT00000032694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPAEPAAELGARAGGMFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLRLEREACLASN
YALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEDSMHRWSPHCALGWLQA
ELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQP
APTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLSP
RPSQPEPPHR
Download sequence
Identical sequences F6XCL3
ENSCJAP00000030938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]