SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031179 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031179
Domain Number 1 Region: 25-146
Classification Level Classification E-value
Superfamily FKBP-like 1.16e-28
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 168-317
Classification Level Classification E-value
Superfamily TPR-like 4.85e-22
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031179   Gene: ENSCJAG00000016944   Transcript: ENSCJAT00000032949
Sequence length 327
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:8463221:8477838:-1 gene:ENSCJAG00000016944 transcript:ENSCJAT00000032949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSALNQGVLEGDDAPGQSPYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDATVLVK
YSGYLEHMDRPFDSNCHRRTPKLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGT
LGCPPLIPPDTTVLFEIELLDFLDSAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFYDAKVRYKRALLLLHRRSAPPDEQHLTEAAKLLILLNLSFTYLKLDRPTLALR
YGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASYY
KDYTDKEKEMCHRMFAPCGDGSTAGQG
Download sequence
Identical sequences F7IM69
ENSCJAP00000031179 ENSCJAP00000031178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]