SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031275 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031275
Domain Number 1 Region: 445-531,648-807
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 3.14e-79
Family Substrate-binding domain of HMG-CoA reductase 0.0000000023
Further Details:      
 
Domain Number 2 Region: 534-650
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.7e-44
Family NAD-binding domain of HMG-CoA reductase 0.00000042
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.000068
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031275   Gene: ENSCJAG00000016954   Transcript: ENSCJAT00000033056
Sequence length 835
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:133017995:133045477:-1 gene:ENSCJAG00000016954 transcript:ENSCJAT00000033056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNDKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVT
QKKVPDNCCRREPLLVRNNQKCDSVEEEMGINRERKAEVIKPLVAETDTPNRATFVVGNS
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKYLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLLEPSSLQYLPYRDYNYSLLGGGASSRVLADGMTRGPV
VRLPRACDSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGD
AMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIP
AKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVG
SSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGE
NARQLARIVCGTVMAGELSLMAALAAGQLVKSHMIHNRSKINLQDLQGTCTKKTA
Download sequence
Identical sequences F7IAF9
ENSCJAP00000031275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]