SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031379 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031379
Domain Number 1 Region: 10-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 4.58e-44
Family Isochorismatase-like hydrolases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031379   Gene: ENSCJAG00000017068   Transcript: ENSCJAT00000033167
Sequence length 221
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:46286784:46296584:-1 gene:ENSCJAG00000017068 transcript:ENSCJAT00000033167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSLGRVFPGSSILFLCDMQEKFRHKIAYFPQIVSVAARMLKVARLLEVPVMLTEQ
YPQGLGPTVPELGAEGLQPLSKTCFSMVPALRQELDSRPQLESVLLCGIEAQACILDPCS
YPGLAPASLYLQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGL
ILQLVGDAANPKFKEIQKLIKEPAPDSGLLGLFQGQNPLLH
Download sequence
Identical sequences F7IRT7
ENSCJAP00000031379 ENSCJAP00000031369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]