SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031409 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000031409
Domain Number - Region: 78-118
Classification Level Classification E-value
Superfamily LysM domain 0.00353
Family LysM domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031409   Gene: ENSCJAG00000017092   Transcript: ENSCJAT00000033201
Sequence length 294
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:7947942:7952538:1 gene:ENSCJAG00000017092 transcript:ENSCJAT00000033201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHNEVSAKTFQGPAVVCRTPTSHVYMFKNGDAGDSSEEESHHTILRPRGKERQKSGVYH
PHQAGAGDIVLLQRELAQEDSLNKLALQYGCKVADIKKANNFIREQDLYALKSIKIPVKN
HGILTETHKELKPLLSPSSETRVTVELPDADRAATGTDAQASQLTDFFKGIDQNIERAVQ
SEIFLHESYCIDASHQPLLPAPLKTPMNGADCGIQWWNAVFIMLLIGIVLPVFYLVYFTI
QASGETLNSLNTTVVPNGSMAVGTVPGQAPRLAVPVPTITSADSQFSQASQAGN
Download sequence
Identical sequences F7IJQ2
ENSCJAP00000031409 ENSCJAP00000031409 XP_008996545.1.60252 XP_008996546.1.60252 XP_008996547.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]