SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031583 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031583
Domain Number 1 Region: 294-402,524-640
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.39e-55
Family Phosphate binding protein-like 0.00000000804
Further Details:      
 
Domain Number 2 Region: 1-234
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000000033
Family L-arabinose binding protein-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031583   Gene: ENSCJAG00000017164   Transcript: ENSCJAT00000033386
Sequence length 1124
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:10104204:10319152:-1 gene:ENSCJAG00000017164 transcript:ENSCJAT00000033386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKIMQDYDWHVFSLVTTIFPGYRDFISFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQV
QLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLI
SVSYDDWDYSLEARVRDGIGILTTAASSMLEKFSYIPEAKASCYGQMERPEVPMHTLHPF
MVNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFS
DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCK
GFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEE
RSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFE
YFSPVGYNRNLAKGKAPQGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFF
AVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNN
YPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFA
TTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNM
AGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIE
EKKKSPDFNLTGSQSNMLKLLRSAKNISNMSNMNSSRIDSPKRAADFIQRGSLIMDMVSD
KGNMMYSDNRSFQGKESIFGDNMNELQTFVANRHKDNLNNYVFQGQHPLTLNESNPNTVE
VAVSTESKVNSRPRQLWKKSMDSIRQDSLSQNPASQRDEGTVENRTHSLKSPRYLPEEMA
HSDISETSSRATCHREPDNNKNHKTKDNFKRPVGSKYPKDCSEVERTYLKTKSSSPRDKI
YTIDGEKEPGFHLDPPQYVENVTLPENVDFPDPYQDHSENFRKGDSTLPINRNPLHNEEG
LPNNEQYKLYSKHFTLKDKGSPHSETSERYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCD
ACLRMGNLYDIDEDQMLQETGMTNAWLLGDAPRTLTNTRCHPRR
Download sequence
Identical sequences F7IRL9
ENSCJAP00000031583 ENSCJAP00000031583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]