SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031589 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031589
Domain Number 1 Region: 25-441
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-145
Family ALDH-like 0.0000000000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031589   Gene: ENSCJAG00000017159   Transcript: ENSCJAT00000033392
Sequence length 445
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:7029814:7067306:-1 gene:ENSCJAG00000017159 transcript:ENSCJAT00000033392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADSSLIKEVGFPPGVVNIVPGFGPTVGAAISSH
PQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVF
FNQGQCCTAASRVFVEEQVYAEFVRRSVEYARKRPVGDPFDVKTEQGPQIDQKQFDKILE
LIESGKKEGAKLECGGSAVEDRGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFRSIEE
VIQRANSTDYGLTAAVFTKNLDKALTLASALESGTVWINCYNALYAQAPFGGFKMSGNGR
ELGEYALAEYTEVKTVTIKLGNKNP
Download sequence
Identical sequences F7IPB9
ENSCJAP00000031589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]