SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031609 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031609
Domain Number 1 Region: 24-144
Classification Level Classification E-value
Superfamily ALDH-like 1.28e-27
Family ALDH-like 0.00000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031609   Gene: ENSCJAG00000017159   Transcript: ENSCJAT00000033414
Sequence length 151
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:7036306:7067346:-1 gene:ENSCJAG00000017159 transcript:ENSCJAT00000033414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRLIRSSSTKS
Download sequence
Identical sequences F7IJK2
ENSCJAP00000031609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]