SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031619 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031619
Domain Number 1 Region: 281-338
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.18e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 22-66
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000235
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031619   Gene: ENSCJAG00000017169   Transcript: ENSCJAT00000033424
Sequence length 338
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:106671684:106716534:-1 gene:ENSCJAG00000017169 transcript:ENSCJAT00000033424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWGCSLLFVLCVERANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTL
WENKLMQSRAVDGFHSETVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAA
ATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGV
QAPVIQQVLAPLPGGISPQAGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQ
PQAQPAQTQAPLVLHDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQ
YDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences F7IHA4
ENSCJAP00000031619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]