SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031721 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031721
Domain Number 1 Region: 359-592
Classification Level Classification E-value
Superfamily HCP-like 2.27e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 566-700
Classification Level Classification E-value
Superfamily HCP-like 9.02e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 6.1e-25
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031721   Gene: ENSCJAG00000017220   Transcript: ENSCJAT00000033529
Sequence length 794
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:106970757:107034828:-1 gene:ENSCJAG00000017220 transcript:ENSCJAT00000033529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVRIGLTLLLCAVLLSSASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDNSFLESPNPENRDYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGIVYFLQY
IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPGPRPA
PPQQEAPPEQQPPQ
Download sequence
Identical sequences F7HYD5
ENSCJAP00000031721 ENSCJAP00000031721 XP_002754215.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]