SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031755 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000031755
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily LEM domain 0.000275
Family LEM domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031755   Gene: ENSCJAG00000017264   Transcript: ENSCJAT00000033566
Sequence length 139
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:27459421:27497702:-1 gene:ENSCJAG00000017264 transcript:ENSCJAT00000033566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAKCLSDCKWQNQLEKLGFSPGPILQLDIIFQGNTLSTEKSKKLKKWLEASTTKPKAV
DTYCLDYKPSKGRRVTARAPSTRITYGTITKERDYCTEDQTAESWREESFPVGMRLAVLG
IFIIAVFVYLTVENKLLFG
Download sequence
Identical sequences F7HS11
ENSCJAP00000031755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]