SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031758 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031758
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily LEM domain 0.000000000334
Family LEM domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000031758
Domain Number - Region: 52-131
Classification Level Classification E-value
Superfamily Bacterial enterotoxins 0.063
Family Superantigen toxins, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031758   Gene: ENSCJAG00000017264   Transcript: ENSCJAT00000033569
Sequence length 179
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:27459421:27497735:-1 gene:ENSCJAG00000017264 transcript:ENSCJAT00000033569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAKCLSDCKWQNQLEKLGFSPGPILPSTRKLYEKSVQLLVSPPCAPPVMNEPRELDGA
QDSDGNEELDIIFQGNTLSTEKSKKLKKWLEASTTKPKAVDTYCLDYKPSKGRRVTARAP
STRITYGTITKERDYCTEDQTAESWREESFPVGMRLAVLGIFIIAVFVYLTVENKLLFG
Download sequence
Identical sequences F7HRZ6
ENSCJAP00000031758 ENSCJAP00000031750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]