SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031817 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031817
Domain Number 1 Region: 221-372
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-27
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 72-105,155-213
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-24
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031817   Gene: ENSCJAG00000017280   Transcript: ENSCJAT00000033630
Sequence length 545
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:113652254:113751468:-1 gene:ENSCJAG00000017280 transcript:ENSCJAT00000033630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEDGFKGDRTEGCCNDSVAVPAAAPVCQPKSATNGQPPAPTPTPTPTPRLSISSRATVVA
RMEGTSQGGLQTVMKWKTVVAIFVVVVVYLVSGGLVFRALEQPFESSQKNTIALEKAEFL
RDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNI
APSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRV
ISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYR
EWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRE
TRRRLSVEIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQ
ESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIY
KTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAEMENGMIPTDTKDQELENNSL
LEDRN
Download sequence
Identical sequences F7IJF9
ENSCJAP00000031817 ENSCJAP00000031817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]