SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031837 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031837
Domain Number 1 Region: 430-567
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.92e-34
Family Mismatch glycosylase 0.000000157
Further Details:      
 
Domain Number 2 Region: 60-180
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-31
Family Methyl-CpG-binding domain, MBD 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031837   Gene: ENSCJAG00000017293   Transcript: ENSCJAT00000033653
Sequence length 571
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:67562282:67571458:1 gene:ENSCJAG00000017293 transcript:ENSCJAT00000033653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISTAGMESLSLGDRGAARAVSSSERLVPDPPCDLRKEDGAVELERVGEDEEQMMMKRSSE
CNPLLQEPIASAQCGGTAGMVCHKSAPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRS
KSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSKYKECSMAVLTSNPQNQSNNSNRNLRT
RSKCKEDVFMSPRSSSELPVTSTHLLLKEDENIDDVYFRKVRKPKGKVTILKGTPMKKTK
KGCRKNCSGFAQSDSKRESVCNKTDAESEPVAQDSQLDRTFCISDAGACGETLSVTNEEK
SLVKERSLSSGSNFCFEQKTSGIINKLHSAKHAEHNEKYEGTFLESEEIGTKVEVGARKE
HLHIDILKHGSEMDNNCPSTKKDFTGEKIFQEDTIPRTQTERRKTSLYFSRKYNKEALSP
PRRKVFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAE
VARNADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFC
VNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Download sequence
Identical sequences F7IH19
ENSCJAP00000031837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]