SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031851 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031851
Domain Number 1 Region: 431-568
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.92e-34
Family Mismatch glycosylase 0.000000157
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-31
Family Methyl-CpG-binding domain, MBD 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031851   Gene: ENSCJAG00000017293   Transcript: ENSCJAT00000033668
Sequence length 572
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:67562282:67571458:1 gene:ENSCJAG00000017293 transcript:ENSCJAT00000033668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISTAGMESLSLGDRGAARAVSSSERNYLPSGGLHLIKEDGAVELERVGEDEEQMMMKRSS
ECNPLLQEPIASAQCGGTAGMVCHKSAPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFR
SKSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSKYKECSMAVLTSNPQNQSNNSNRNLR
TRSKCKEDVFMSPRSSSELPVTSTHLLLKEDENIDDVYFRKVRKPKGKVTILKGTPMKKT
KKGCRKNCSGFAQSDSKRESVCNKTDAESEPVAQDSQLDRTFCISDAGACGETLSVTNEE
KSLVKERSLSSGSNFCFEQKTSGIINKLHSAKHAEHNEKYEGTFLESEEIGTKVEVGARK
EHLHIDILKHGSEMDNNCPSTKKDFTGEKIFQEDTIPRTQTERRKTSLYFSRKYNKEALS
PPRRKVFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSA
EVARNADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIF
CVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Download sequence
Identical sequences F7ICB3
ENSCJAP00000031837 ENSCJAP00000031851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]